PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g26180.1.p
Common NameBRADI_4g26180, LOC100830968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 264aa    MW: 28858.5 Da    PI: 6.4995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g26180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.1e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv +v+++G+g+W+++++  g+ R+ k+c++rw +yl
  Bradi4g26180.1.p 14 KGPWTPEEDLVLVSYVQEHGPGNWRSVPASTGLARCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding47.93.1e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T++Ed  ++++  +lG++ W++Ia +++ +Rt++++k++w+++l
  Bradi4g26180.1.p  67 RGSFTPQEDAVIAHLQSLLGNR-WAAIATYLP-KRTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.418965IPR017930Myb domain
SuperFamilySSF466891.09E-3011108IPR009057Homeodomain-like
SMARTSM007175.8E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001677.92E-121661No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.966116IPR017930Myb domain
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002493.0E-1467112IPR001005SANT/Myb domain
CDDcd001674.98E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLVLVSYVQ EHGPGNWRSV PASTGLARCS KSCRLRWTNY  60
LRPGIRRGSF TPQEDAVIAH LQSLLGNRWA AIATYLPKRT DNDIKNYWNT HLKKRLQKQQ  120
AVGAIFAPPP TESAACSFSS PSSLSYASSV DNISRLLDGF MKASLPPPAS SAPTTQSSQS  180
VSDAKDKPGH AAVHFIDADE YPMFPAFHDD GCCISGSFAS DQQQQVPLSS IEEWLFDEAV  240
EPKMMDQLAS SSDECYSLVP MLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-28141164105MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-281411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-281411658159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-28141164105C-Myb DNA-Binding Domain
1msf_C2e-28141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576343.10.0PREDICTED: myb-related protein 306-like
TrEMBLI1INP50.0I1INP5_BRADI; Uncharacterized protein
STRINGBRADI4G26180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-80myb domain protein 60